Description
Product Description
Protein Description: kelch repeat and BTB (POZ) domain containing 8
Gene Name: KBTBD8
Alternative Gene Name: KIAA1842, TA-KRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030031: 99%, ENSRNOG00000013390: 99%
Entrez Gene ID: 84541
Uniprot ID: Q8NFY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KBTBD8
Alternative Gene Name: KIAA1842, TA-KRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030031: 99%, ENSRNOG00000013390: 99%
Entrez Gene ID: 84541
Uniprot ID: Q8NFY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQK |
Gene Sequence | NKWTRKKDFPCDQSINPYLKLVLFQNKLHLFVRATQVTVEEHVFRTSRKNSLYQYDDIADQWMKVYETPDRLWDLGRHFECAVAKLYPQCLQK |
Gene ID - Mouse | ENSMUSG00000030031 |
Gene ID - Rat | ENSRNOG00000013390 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KBTBD8 pAb (ATL-HPA069190) | |
Datasheet | Anti KBTBD8 pAb (ATL-HPA069190) Datasheet (External Link) |
Vendor Page | Anti KBTBD8 pAb (ATL-HPA069190) at Atlas Antibodies |
Documents & Links for Anti KBTBD8 pAb (ATL-HPA069190) | |
Datasheet | Anti KBTBD8 pAb (ATL-HPA069190) Datasheet (External Link) |
Vendor Page | Anti KBTBD8 pAb (ATL-HPA069190) |