Anti KBTBD13 pAb (ATL-HPA062737)

Atlas Antibodies

Catalog No: ATL-HPA062737-25

• 

Product Description

Protein Description: kelch repeat and BTB (POZ) domain containing 13
Gene Name: KBTBD13
Alternative Gene Name: hCG_1645727, NEM6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054978: 93%, ENSRNOG00000002875: 38%
Entrez Gene ID: 390594
Uniprot ID: C9JR72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
• Gene Sequence: LEASTLLAGVATLGNKLYIVGGVRGASKEVVELGFCYDPDGGTWHEFPSPHQPRYDTALAGFDGRLYAIG
• Gene ID - Mouse: ENSMUSG00000054978
• Gene ID - Rat: ENSRNOG00000002875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.