Anti KATNBL1 pAb (ATL-HPA062573)

Atlas Antibodies

Catalog No: ATL-HPA062573-25

• 
• 
• 

Product Description

Protein Description: katanin p80 subunit B-like 1
Gene Name: KATNBL1
Alternative Gene Name: C15orf29, FLJ22557
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027132: 87%, ENSRNOG00000005814: 87%
Entrez Gene ID: 79768
Uniprot ID: Q9H079
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY
• Gene Sequence: KQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKY
• Gene ID - Mouse: ENSMUSG00000027132
• Gene ID - Rat: ENSRNOG00000005814
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.