Protein Description: K(lysine) acetyltransferase 8
Gene Name: KAT8
Alternative Gene Name: FLJ14040, hMOF, MOF, MYST1, ZC2HC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030801: 100%, ENSRNOG00000019585: 100%
Entrez Gene ID: 84148
Uniprot ID: Q9H7Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KAT8
Alternative Gene Name: FLJ14040, hMOF, MOF, MYST1, ZC2HC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030801: 100%, ENSRNOG00000019585: 100%
Entrez Gene ID: 84148
Uniprot ID: Q9H7Z6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHE |
| Documents & Links for Anti KAT8 pAb (ATL-HPA066324) | |
| Datasheet | Anti KAT8 pAb (ATL-HPA066324) Datasheet (External Link) |
| Vendor Page | Anti KAT8 pAb (ATL-HPA066324) at Atlas |
| Documents & Links for Anti KAT8 pAb (ATL-HPA066324) | |
| Datasheet | Anti KAT8 pAb (ATL-HPA066324) Datasheet (External Link) |
| Vendor Page | Anti KAT8 pAb (ATL-HPA066324) |