Protein Description: lysine acetyltransferase 7
Gene Name: KAT7
Alternative Gene Name: HBO1, HBOA, MYST2, ZC2HC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038909: 100%, ENSRNOG00000022664: 99%
Entrez Gene ID: 11143
Uniprot ID: O95251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KAT7
Alternative Gene Name: HBO1, HBOA, MYST2, ZC2HC7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038909: 100%, ENSRNOG00000022664: 99%
Entrez Gene ID: 11143
Uniprot ID: O95251
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNF |
Documents & Links for Anti KAT7 pAb (ATL-HPA071116) | |
Datasheet | Anti KAT7 pAb (ATL-HPA071116) Datasheet (External Link) |
Vendor Page | Anti KAT7 pAb (ATL-HPA071116) at Atlas |
Documents & Links for Anti KAT7 pAb (ATL-HPA071116) | |
Datasheet | Anti KAT7 pAb (ATL-HPA071116) Datasheet (External Link) |
Vendor Page | Anti KAT7 pAb (ATL-HPA071116) |