Anti KAT6A pAb (ATL-HPA063266)

Atlas Antibodies

Catalog No: ATL-HPA063266-25

• 

Product Description

Protein Description: K(lysine) acetyltransferase 6A
Gene Name: KAT6A
Alternative Gene Name: MOZ, MYST3, RUNXBP2, ZC2HC6A, ZNF220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031540: 67%, ENSRNOG00000025174: 61%
Entrez Gene ID: 7994
Uniprot ID: Q92794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE
• Gene Sequence: SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE
• Gene ID - Mouse: ENSMUSG00000031540
• Gene ID - Rat: ENSRNOG00000025174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.