Description
Product Description
Protein Description: K(lysine) acetyltransferase 6A
Gene Name: KAT6A
Alternative Gene Name: MOZ, MYST3, RUNXBP2, ZC2HC6A, ZNF220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031540: 67%, ENSRNOG00000025174: 61%
Entrez Gene ID: 7994
Uniprot ID: Q92794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KAT6A
Alternative Gene Name: MOZ, MYST3, RUNXBP2, ZC2HC6A, ZNF220
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031540: 67%, ENSRNOG00000025174: 61%
Entrez Gene ID: 7994
Uniprot ID: Q92794
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE |
Gene Sequence | SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE |
Gene ID - Mouse | ENSMUSG00000031540 |
Gene ID - Rat | ENSRNOG00000025174 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KAT6A pAb (ATL-HPA063266) | |
Datasheet | Anti KAT6A pAb (ATL-HPA063266) Datasheet (External Link) |
Vendor Page | Anti KAT6A pAb (ATL-HPA063266) at Atlas Antibodies |
Documents & Links for Anti KAT6A pAb (ATL-HPA063266) | |
Datasheet | Anti KAT6A pAb (ATL-HPA063266) Datasheet (External Link) |
Vendor Page | Anti KAT6A pAb (ATL-HPA063266) |