Anti KAT14 pAb (ATL-HPA068443)

Atlas Antibodies

Catalog No: ATL-HPA068443-25

• 

Product Description

Protein Description: lysine acetyltransferase 14
Gene Name: KAT14
Alternative Gene Name: ATAC2, CRP2BP, CSRP2BP, dJ717M23.1, PRO1194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027425: 92%, ENSRNOG00000007160: 94%
Entrez Gene ID: 57325
Uniprot ID: Q9H8E8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH
• Gene Sequence: IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFLYRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH
• Gene ID - Mouse: ENSMUSG00000027425
• Gene ID - Rat: ENSRNOG00000007160
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.