Description
Product Description
Protein Description: jun D proto-oncogene
Gene Name: JUND
Alternative Gene Name: AP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110974: 98%, ENSRNOG00000019568: 98%
Entrez Gene ID: 3727
Uniprot ID: P17535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JUND
Alternative Gene Name: AP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110974: 98%, ENSRNOG00000019568: 98%
Entrez Gene ID: 3727
Uniprot ID: P17535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED |
| Gene Sequence | IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED |
| Gene ID - Mouse | ENSMUSG00000110974 |
| Gene ID - Rat | ENSRNOG00000019568 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti JUND pAb (ATL-HPA063029) | |
| Datasheet | Anti JUND pAb (ATL-HPA063029) Datasheet (External Link) |
| Vendor Page | Anti JUND pAb (ATL-HPA063029) at Atlas Antibodies |
| Documents & Links for Anti JUND pAb (ATL-HPA063029) | |
| Datasheet | Anti JUND pAb (ATL-HPA063029) Datasheet (External Link) |
| Vendor Page | Anti JUND pAb (ATL-HPA063029) |