Anti JPH3 pAb (ATL-HPA076304)

Atlas Antibodies

Catalog No: ATL-HPA076304-25

• 

Product Description

Protein Description: junctophilin 3
Gene Name: JPH3
Alternative Gene Name: CAGL237, HDL2, JP-3, JP3, TNRC22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025318: 67%, ENSRNOG00000018784: 74%
Entrez Gene ID: 57338
Uniprot ID: Q8WXH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF
• Gene Sequence: KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF
• Gene ID - Mouse: ENSMUSG00000025318
• Gene ID - Rat: ENSRNOG00000018784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.