Description
Product Description
Protein Description: junctophilin 3
Gene Name: JPH3
Alternative Gene Name: CAGL237, HDL2, JP-3, JP3, TNRC22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025318: 67%, ENSRNOG00000018784: 74%
Entrez Gene ID: 57338
Uniprot ID: Q8WXH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JPH3
Alternative Gene Name: CAGL237, HDL2, JP-3, JP3, TNRC22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025318: 67%, ENSRNOG00000018784: 74%
Entrez Gene ID: 57338
Uniprot ID: Q8WXH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF |
Gene Sequence | KRRYSKGGACRGLGDDHRPEDRGFGVQRLRSKAQNKENFRPASSAEPAVQKLASLRLGGAEPRLLRWDLTF |
Gene ID - Mouse | ENSMUSG00000025318 |
Gene ID - Rat | ENSRNOG00000018784 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti JPH3 pAb (ATL-HPA076304) | |
Datasheet | Anti JPH3 pAb (ATL-HPA076304) Datasheet (External Link) |
Vendor Page | Anti JPH3 pAb (ATL-HPA076304) at Atlas Antibodies |
Documents & Links for Anti JPH3 pAb (ATL-HPA076304) | |
Datasheet | Anti JPH3 pAb (ATL-HPA076304) Datasheet (External Link) |
Vendor Page | Anti JPH3 pAb (ATL-HPA076304) |