Polyclonal Antibody against Human JMJD6, Gene description: jumonji domain containing 6, arginine demethylase and lysine hydroxylase, Alternative Gene Names: KIAA0585, PTDSR, PTDSR1, Validated applications: IHC, Uniprot ID: Q6NYC1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications |
| Application |
IHC |
| Reactivity |
Human |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene Sequence |
MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA |
| Gene ID - Mouse |
ENSMUSG00000056962 |
| Gene ID - Rat |
ENSMUSG00000056962 |
| Buffer |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
