Polyclonal Antibody against Human JMJD6, Gene description: jumonji domain containing 6, arginine demethylase and lysine hydroxylase, Alternative Gene Names: KIAA0585, PTDSR, PTDSR1, Validated applications: IHC, Uniprot ID: Q6NYC1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA |
Gene ID - Mouse | ENSMUSG00000056962 |
Gene ID - Rat | ENSMUSG00000056962 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti-JMJD6 pAb (ATL-HPA074031) | |
Vendor Page | Anti-JMJD6 pAb (ATL-HPA074031) at Atlas |
Documents & Links for Anti-JMJD6 pAb (ATL-HPA074031) | |
Vendor Page | Anti-JMJD6 pAb (ATL-HPA074031) |