Protein Description: JNK1/MAPK8-associated membrane protein
Gene Name: JKAMP
Alternative Gene Name: C14orf100, CDA06, HSPC213, HSPC327, JAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005078: 90%, ENSRNOG00000004751: 90%
Entrez Gene ID: 51528
Uniprot ID: Q9P055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JKAMP
Alternative Gene Name: C14orf100, CDA06, HSPC213, HSPC327, JAMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005078: 90%, ENSRNOG00000004751: 90%
Entrez Gene ID: 51528
Uniprot ID: Q9P055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TFRRPMAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYD |
Documents & Links for Anti JKAMP pAb (ATL-HPA071650) | |
Datasheet | Anti JKAMP pAb (ATL-HPA071650) Datasheet (External Link) |
Vendor Page | Anti JKAMP pAb (ATL-HPA071650) at Atlas |
Documents & Links for Anti JKAMP pAb (ATL-HPA071650) | |
Datasheet | Anti JKAMP pAb (ATL-HPA071650) Datasheet (External Link) |
Vendor Page | Anti JKAMP pAb (ATL-HPA071650) |