Protein Description: JAZF zinc finger 1
Gene Name: JAZF1
Alternative Gene Name: DKFZp761K2222, TIP27, ZNF802
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063568: 100%, ENSRNOG00000027026: 100%
Entrez Gene ID: 221895
Uniprot ID: Q86VZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JAZF1
Alternative Gene Name: DKFZp761K2222, TIP27, ZNF802
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063568: 100%, ENSRNOG00000027026: 100%
Entrez Gene ID: 221895
Uniprot ID: Q86VZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAIL |
| Documents & Links for Anti JAZF1 pAb (ATL-HPA066967) | |
| Datasheet | Anti JAZF1 pAb (ATL-HPA066967) Datasheet (External Link) |
| Vendor Page | Anti JAZF1 pAb (ATL-HPA066967) at Atlas |
| Documents & Links for Anti JAZF1 pAb (ATL-HPA066967) | |
| Datasheet | Anti JAZF1 pAb (ATL-HPA066967) Datasheet (External Link) |
| Vendor Page | Anti JAZF1 pAb (ATL-HPA066967) |
| Citations for Anti JAZF1 pAb (ATL-HPA066967) – 1 Found |
| Procida, Tara; Friedrich, Tobias; Jack, Antonia P M; Peritore, Martina; Bönisch, Clemens; Eberl, H Christian; Daus, Nadine; Kletenkov, Konstantin; Nist, Andrea; Stiewe, Thorsten; Borggrefe, Tilman; Mann, Matthias; Bartkuhn, Marek; Hake, Sandra B. JAZF1, A Novel p400/TIP60/NuA4 Complex Member, Regulates H2A.Z Acetylation at Regulatory Regions. International Journal Of Molecular Sciences. 2021;22(2) PubMed |