Protein Description: jumonji, AT rich interactive domain 2
Gene Name: JARID2
Alternative Gene Name: JMJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038518: 96%, ENSRNOG00000045918: 98%
Entrez Gene ID: 3720
Uniprot ID: Q92833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JARID2
Alternative Gene Name: JMJ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038518: 96%, ENSRNOG00000045918: 98%
Entrez Gene ID: 3720
Uniprot ID: Q92833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR |
Documents & Links for Anti JARID2 pAb (ATL-HPA063889) | |
Datasheet | Anti JARID2 pAb (ATL-HPA063889) Datasheet (External Link) |
Vendor Page | Anti JARID2 pAb (ATL-HPA063889) at Atlas |
Documents & Links for Anti JARID2 pAb (ATL-HPA063889) | |
Datasheet | Anti JARID2 pAb (ATL-HPA063889) Datasheet (External Link) |
Vendor Page | Anti JARID2 pAb (ATL-HPA063889) |