Protein Description: janus kinase and microtubule interacting protein 2
Gene Name: JAKMIP2
Alternative Gene Name: JAMIP2, KIAA0555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024502: 100%, ENSRNOG00000019159: 99%
Entrez Gene ID: 9832
Uniprot ID: Q96AA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JAKMIP2
Alternative Gene Name: JAMIP2, KIAA0555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024502: 100%, ENSRNOG00000019159: 99%
Entrez Gene ID: 9832
Uniprot ID: Q96AA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RETEKQCKPLLERNKCLAKRNDELMVSLQRMEEKLKAVTKENSEMREKITSHPPLKKLKSLNDLDQANEEQ |
Documents & Links for Anti JAKMIP2 pAb (ATL-HPA065023) | |
Datasheet | Anti JAKMIP2 pAb (ATL-HPA065023) Datasheet (External Link) |
Vendor Page | Anti JAKMIP2 pAb (ATL-HPA065023) at Atlas |
Documents & Links for Anti JAKMIP2 pAb (ATL-HPA065023) | |
Datasheet | Anti JAKMIP2 pAb (ATL-HPA065023) Datasheet (External Link) |
Vendor Page | Anti JAKMIP2 pAb (ATL-HPA065023) |