Protein Description: jagged 2
Gene Name: JAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002799: 99%, ENSRNOG00000007443: 54%
Entrez Gene ID: 3714
Uniprot ID: Q9Y219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JAG2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002799: 99%, ENSRNOG00000007443: 54%
Entrez Gene ID: 3714
Uniprot ID: Q9Y219
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYS |
| Gene ID - Mouse | ENSMUSG00000002799 |
| Gene ID - Rat | ENSMUSG00000002799 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti JAG2 pAb (ATL-HPA030636) | |
| Datasheet | Anti JAG2 pAb (ATL-HPA030636) Datasheet (External Link) |
| Vendor Page | Anti JAG2 pAb (ATL-HPA030636) at Atlas |
| Documents & Links for Anti JAG2 pAb (ATL-HPA030636) | |
| Datasheet | Anti JAG2 pAb (ATL-HPA030636) Datasheet (External Link) |
| Vendor Page | Anti JAG2 pAb (ATL-HPA030636) |