Description
Product Description
Protein Description: jade family PHD finger 2
Gene Name: JADE2
Alternative Gene Name: JADE-2, KIAA0239, PHF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020387: 96%, ENSRNOG00000004956: 96%
Entrez Gene ID: 23338
Uniprot ID: Q9NQC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JADE2
Alternative Gene Name: JADE-2, KIAA0239, PHF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020387: 96%, ENSRNOG00000004956: 96%
Entrez Gene ID: 23338
Uniprot ID: Q9NQC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG |
Gene Sequence | IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG |
Gene ID - Mouse | ENSMUSG00000020387 |
Gene ID - Rat | ENSRNOG00000004956 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti JADE2 pAb (ATL-HPA055789) | |
Datasheet | Anti JADE2 pAb (ATL-HPA055789) Datasheet (External Link) |
Vendor Page | Anti JADE2 pAb (ATL-HPA055789) at Atlas Antibodies |
Documents & Links for Anti JADE2 pAb (ATL-HPA055789) | |
Datasheet | Anti JADE2 pAb (ATL-HPA055789) Datasheet (External Link) |
Vendor Page | Anti JADE2 pAb (ATL-HPA055789) |