Anti JADE2 pAb (ATL-HPA055789)

Atlas Antibodies

Catalog No: ATL-HPA055789-25

• 

Product Description

Protein Description: jade family PHD finger 2
Gene Name: JADE2
Alternative Gene Name: JADE-2, KIAA0239, PHF15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020387: 96%, ENSRNOG00000004956: 96%
Entrez Gene ID: 23338
Uniprot ID: Q9NQC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG
• Gene Sequence: IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG
• Gene ID - Mouse: ENSMUSG00000020387
• Gene ID - Rat: ENSRNOG00000004956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.