Description
Product Description
Protein Description: jade family PHD finger 1
Gene Name: JADE1
Alternative Gene Name: JADE-1, PHF17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025764: 84%, ENSRNOG00000014066: 86%
Entrez Gene ID: 79960
Uniprot ID: Q6IE81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JADE1
Alternative Gene Name: JADE-1, PHF17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025764: 84%, ENSRNOG00000014066: 86%
Entrez Gene ID: 79960
Uniprot ID: Q6IE81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL |
Gene Sequence | VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL |
Gene ID - Mouse | ENSMUSG00000025764 |
Gene ID - Rat | ENSRNOG00000014066 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti JADE1 pAb (ATL-HPA020016) | |
Datasheet | Anti JADE1 pAb (ATL-HPA020016) Datasheet (External Link) |
Vendor Page | Anti JADE1 pAb (ATL-HPA020016) at Atlas Antibodies |
Documents & Links for Anti JADE1 pAb (ATL-HPA020016) | |
Datasheet | Anti JADE1 pAb (ATL-HPA020016) Datasheet (External Link) |
Vendor Page | Anti JADE1 pAb (ATL-HPA020016) |