Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061866-25

• 
• 

Product Description

Protein Description: IWS1 homolog (S. cerevisiae)
Gene Name: IWS1
Alternative Gene Name: DKFZp761G0123, FLJ10006, FLJ14655, FLJ32319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024384: 83%, ENSRNOG00000014630: 83%
Entrez Gene ID: 55677
Uniprot ID: Q96ST2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND
• Gene Sequence: NEELPKPRISDSESEDPPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQND
• Gene ID - Mouse: ENSMUSG00000024384
• Gene ID - Rat: ENSRNOG00000014630
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti IWS1 pAb (ATL-HPA061866 w/enhanced validation) – 1 Found

Orlacchio, Arturo; Stark, Aaron E; Foray, Claudia; Amari, Foued; Sheetz, Tyler; Reese, Erika; Tessari, Anna; La Perle, Krista; Palmieri, Dario; Tsichlis, Philip N; Coppola, Vincenzo. Genetic ablation of interacting with Spt6 (Iws1) causes early embryonic lethality. Plos One. 13(9):e0201030.