Anti ITPR2 pAb (ATL-HPA062260)

Catalog No:
ATL-HPA062260-25
$447.00

Description

Product Description

Protein Description: inositol 1,4,5-trisphosphate receptor, type 2
Gene Name: ITPR2
Alternative Gene Name: CFAP48, IP3R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030287: 94%, ENSRNOG00000001804: 94%
Entrez Gene ID: 3709
Uniprot ID: Q14571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLT
Gene Sequence LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLT
Gene ID - Mouse ENSMUSG00000030287
Gene ID - Rat ENSRNOG00000001804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ITPR2 pAb (ATL-HPA062260)
Datasheet Anti ITPR2 pAb (ATL-HPA062260) Datasheet (External Link)
Vendor Page Anti ITPR2 pAb (ATL-HPA062260) at Atlas Antibodies

Documents & Links for Anti ITPR2 pAb (ATL-HPA062260)
Datasheet Anti ITPR2 pAb (ATL-HPA062260) Datasheet (External Link)
Vendor Page Anti ITPR2 pAb (ATL-HPA062260)

Product Description

Protein Description: inositol 1,4,5-trisphosphate receptor, type 2
Gene Name: ITPR2
Alternative Gene Name: CFAP48, IP3R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030287: 94%, ENSRNOG00000001804: 94%
Entrez Gene ID: 3709
Uniprot ID: Q14571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLT
Gene Sequence LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLT
Gene ID - Mouse ENSMUSG00000030287
Gene ID - Rat ENSRNOG00000001804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ITPR2 pAb (ATL-HPA062260)
Datasheet Anti ITPR2 pAb (ATL-HPA062260) Datasheet (External Link)
Vendor Page Anti ITPR2 pAb (ATL-HPA062260) at Atlas Antibodies

Documents & Links for Anti ITPR2 pAb (ATL-HPA062260)
Datasheet Anti ITPR2 pAb (ATL-HPA062260) Datasheet (External Link)
Vendor Page Anti ITPR2 pAb (ATL-HPA062260)