Protein Description: inositol 1,4,5-trisphosphate receptor, type 2
Gene Name: ITPR2
Alternative Gene Name: CFAP48, IP3R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030287: 94%, ENSRNOG00000001804: 94%
Entrez Gene ID: 3709
Uniprot ID: Q14571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITPR2
Alternative Gene Name: CFAP48, IP3R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030287: 94%, ENSRNOG00000001804: 94%
Entrez Gene ID: 3709
Uniprot ID: Q14571
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGTKADLEVLT |
Documents & Links for Anti ITPR2 pAb (ATL-HPA062260) | |
Datasheet | Anti ITPR2 pAb (ATL-HPA062260) Datasheet (External Link) |
Vendor Page | Anti ITPR2 pAb (ATL-HPA062260) at Atlas |
Documents & Links for Anti ITPR2 pAb (ATL-HPA062260) | |
Datasheet | Anti ITPR2 pAb (ATL-HPA062260) Datasheet (External Link) |
Vendor Page | Anti ITPR2 pAb (ATL-HPA062260) |