Description
Product Description
Protein Description: inositol-trisphosphate 3-kinase B
Gene Name: ITPKB
Alternative Gene Name: IP3-3KB, IP3KB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038855: 61%, ENSRNOG00000002969: 59%
Entrez Gene ID: 3707
Uniprot ID: P27987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITPKB
Alternative Gene Name: IP3-3KB, IP3KB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038855: 61%, ENSRNOG00000002969: 59%
Entrez Gene ID: 3707
Uniprot ID: P27987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQR |
Gene Sequence | GGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQR |
Gene ID - Mouse | ENSMUSG00000038855 |
Gene ID - Rat | ENSRNOG00000002969 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ITPKB pAb (ATL-HPA072923) | |
Datasheet | Anti ITPKB pAb (ATL-HPA072923) Datasheet (External Link) |
Vendor Page | Anti ITPKB pAb (ATL-HPA072923) at Atlas Antibodies |
Documents & Links for Anti ITPKB pAb (ATL-HPA072923) | |
Datasheet | Anti ITPKB pAb (ATL-HPA072923) Datasheet (External Link) |
Vendor Page | Anti ITPKB pAb (ATL-HPA072923) |