Anti ITPKB pAb (ATL-HPA072923)

Catalog No:
ATL-HPA072923-25
$303.00

Description

Product Description

Protein Description: inositol-trisphosphate 3-kinase B
Gene Name: ITPKB
Alternative Gene Name: IP3-3KB, IP3KB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038855: 61%, ENSRNOG00000002969: 59%
Entrez Gene ID: 3707
Uniprot ID: P27987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQR
Gene Sequence GGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQR
Gene ID - Mouse ENSMUSG00000038855
Gene ID - Rat ENSRNOG00000002969
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ITPKB pAb (ATL-HPA072923)
Datasheet Anti ITPKB pAb (ATL-HPA072923) Datasheet (External Link)
Vendor Page Anti ITPKB pAb (ATL-HPA072923) at Atlas Antibodies

Documents & Links for Anti ITPKB pAb (ATL-HPA072923)
Datasheet Anti ITPKB pAb (ATL-HPA072923) Datasheet (External Link)
Vendor Page Anti ITPKB pAb (ATL-HPA072923)

Product Description

Protein Description: inositol-trisphosphate 3-kinase B
Gene Name: ITPKB
Alternative Gene Name: IP3-3KB, IP3KB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038855: 61%, ENSRNOG00000002969: 59%
Entrez Gene ID: 3707
Uniprot ID: P27987
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQR
Gene Sequence GGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQR
Gene ID - Mouse ENSMUSG00000038855
Gene ID - Rat ENSRNOG00000002969
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ITPKB pAb (ATL-HPA072923)
Datasheet Anti ITPKB pAb (ATL-HPA072923) Datasheet (External Link)
Vendor Page Anti ITPKB pAb (ATL-HPA072923) at Atlas Antibodies

Documents & Links for Anti ITPKB pAb (ATL-HPA072923)
Datasheet Anti ITPKB pAb (ATL-HPA072923) Datasheet (External Link)
Vendor Page Anti ITPKB pAb (ATL-HPA072923)