![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101216/181288/atl-hpa073963_anti-itpa-pab-atl-hpa073963_62956__52422.1681137580.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: inosine triphosphatase
Gene Name: ITPA
Alternative Gene Name: C20orf37, dJ794I6.3, HLC14-06-P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074797: 93%, ENSRNOG00000021233: 96%
Entrez Gene ID: 3704
Uniprot ID: Q9BY32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITPA
Alternative Gene Name: C20orf37, dJ794I6.3, HLC14-06-P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074797: 93%, ENSRNOG00000021233: 96%
Entrez Gene ID: 3704
Uniprot ID: Q9BY32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQL |
| Documents & Links for Anti ITPA pAb (ATL-HPA073963) | |
| Datasheet | Anti ITPA pAb (ATL-HPA073963) Datasheet (External Link) |
| Vendor Page | Anti ITPA pAb (ATL-HPA073963) at Atlas |
| Documents & Links for Anti ITPA pAb (ATL-HPA073963) | |
| Datasheet | Anti ITPA pAb (ATL-HPA073963) Datasheet (External Link) |
| Vendor Page | Anti ITPA pAb (ATL-HPA073963) |