Anti ITM2B pAb (ATL-HPA071992)

Catalog No:
ATL-HPA071992-25
$447.00

Description

Product Description

Protein Description: integral membrane protein 2B
Gene Name: ITM2B
Alternative Gene Name: BRI, BRI2, BRICD2B, E25B, E3-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022108: 94%, ENSRNOG00000016271: 96%
Entrez Gene ID: 9445
Uniprot ID: Q9Y287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA
Gene Sequence MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA
Gene ID - Mouse ENSMUSG00000022108
Gene ID - Rat ENSRNOG00000016271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ITM2B pAb (ATL-HPA071992)
Datasheet Anti ITM2B pAb (ATL-HPA071992) Datasheet (External Link)
Vendor Page Anti ITM2B pAb (ATL-HPA071992) at Atlas Antibodies

Documents & Links for Anti ITM2B pAb (ATL-HPA071992)
Datasheet Anti ITM2B pAb (ATL-HPA071992) Datasheet (External Link)
Vendor Page Anti ITM2B pAb (ATL-HPA071992)

Product Description

Protein Description: integral membrane protein 2B
Gene Name: ITM2B
Alternative Gene Name: BRI, BRI2, BRICD2B, E25B, E3-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022108: 94%, ENSRNOG00000016271: 96%
Entrez Gene ID: 9445
Uniprot ID: Q9Y287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA
Gene Sequence MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA
Gene ID - Mouse ENSMUSG00000022108
Gene ID - Rat ENSRNOG00000016271
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ITM2B pAb (ATL-HPA071992)
Datasheet Anti ITM2B pAb (ATL-HPA071992) Datasheet (External Link)
Vendor Page Anti ITM2B pAb (ATL-HPA071992) at Atlas Antibodies

Documents & Links for Anti ITM2B pAb (ATL-HPA071992)
Datasheet Anti ITM2B pAb (ATL-HPA071992) Datasheet (External Link)
Vendor Page Anti ITM2B pAb (ATL-HPA071992)