Description
Product Description
Protein Description: integral membrane protein 2B
Gene Name: ITM2B
Alternative Gene Name: BRI, BRI2, BRICD2B, E25B, E3-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022108: 94%, ENSRNOG00000016271: 96%
Entrez Gene ID: 9445
Uniprot ID: Q9Y287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITM2B
Alternative Gene Name: BRI, BRI2, BRICD2B, E25B, E3-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022108: 94%, ENSRNOG00000016271: 96%
Entrez Gene ID: 9445
Uniprot ID: Q9Y287
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA |
Gene Sequence | MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRA |
Gene ID - Mouse | ENSMUSG00000022108 |
Gene ID - Rat | ENSRNOG00000016271 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ITM2B pAb (ATL-HPA071992) | |
Datasheet | Anti ITM2B pAb (ATL-HPA071992) Datasheet (External Link) |
Vendor Page | Anti ITM2B pAb (ATL-HPA071992) at Atlas Antibodies |
Documents & Links for Anti ITM2B pAb (ATL-HPA071992) | |
Datasheet | Anti ITM2B pAb (ATL-HPA071992) Datasheet (External Link) |
Vendor Page | Anti ITM2B pAb (ATL-HPA071992) |