Description
Product Description
Protein Description: intelectin 1
Gene Name: ITLN1
Alternative Gene Name: FLJ20022, hIntL, HL-1, ITLN, LFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038209: 86%, ENSRNOG00000004678: 84%
Entrez Gene ID: 55600
Uniprot ID: Q8WWA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITLN1
Alternative Gene Name: FLJ20022, hIntL, HL-1, ITLN, LFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038209: 86%, ENSRNOG00000004678: 84%
Entrez Gene ID: 55600
Uniprot ID: Q8WWA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS |
Gene Sequence | DGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNS |
Gene ID - Mouse | ENSMUSG00000038209 |
Gene ID - Rat | ENSRNOG00000004678 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ITLN1 pAb (ATL-HPA067326) | |
Datasheet | Anti ITLN1 pAb (ATL-HPA067326) Datasheet (External Link) |
Vendor Page | Anti ITLN1 pAb (ATL-HPA067326) at Atlas Antibodies |
Documents & Links for Anti ITLN1 pAb (ATL-HPA067326) | |
Datasheet | Anti ITLN1 pAb (ATL-HPA067326) Datasheet (External Link) |
Vendor Page | Anti ITLN1 pAb (ATL-HPA067326) |