Protein Description: integrin beta 1 binding protein 1
Gene Name: ITGB1BP1
Alternative Gene Name: ICAP-1A, ICAP-1alpha, ICAP-1B, ICAP1, ICAP1A, ICAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062352: 95%, ENSRNOG00000059402: 95%
Entrez Gene ID: 9270
Uniprot ID: O14713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITGB1BP1
Alternative Gene Name: ICAP-1A, ICAP-1alpha, ICAP-1B, ICAP1, ICAP1A, ICAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062352: 95%, ENSRNOG00000059402: 95%
Entrez Gene ID: 9270
Uniprot ID: O14713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEK |
| Documents & Links for Anti ITGB1BP1 pAb (ATL-HPA071538) | |
| Datasheet | Anti ITGB1BP1 pAb (ATL-HPA071538) Datasheet (External Link) |
| Vendor Page | Anti ITGB1BP1 pAb (ATL-HPA071538) at Atlas |
| Documents & Links for Anti ITGB1BP1 pAb (ATL-HPA071538) | |
| Datasheet | Anti ITGB1BP1 pAb (ATL-HPA071538) Datasheet (External Link) |
| Vendor Page | Anti ITGB1BP1 pAb (ATL-HPA071538) |
| Citations for Anti ITGB1BP1 pAb (ATL-HPA071538) – 1 Found |
| Stojic, Lovorka; Lun, Aaron T L; Mascalchi, Patrice; Ernst, Christina; Redmond, Aisling M; Mangei, Jasmin; Barr, Alexis R; Bousgouni, Vicky; Bakal, Chris; Marioni, John C; Odom, Duncan T; Gergely, Fanni. A high-content RNAi screen reveals multiple roles for long noncoding RNAs in cell division. Nature Communications. 2020;11(1):1851. PubMed |