Description
Product Description
Protein Description: integrin subunit beta 1 binding protein 1
Gene Name: ITGB1BP1
Alternative Gene Name: ICAP-1A, ICAP-1alpha, ICAP-1B, ICAP1, ICAP1A, ICAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062352: 96%, ENSRNOG00000059402: 96%
Entrez Gene ID: 9270
Uniprot ID: O14713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITGB1BP1
Alternative Gene Name: ICAP-1A, ICAP-1alpha, ICAP-1B, ICAP1, ICAP1A, ICAP1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062352: 96%, ENSRNOG00000059402: 96%
Entrez Gene ID: 9270
Uniprot ID: O14713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT |
Gene Sequence | VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT |
Gene ID - Mouse | ENSMUSG00000062352 |
Gene ID - Rat | ENSRNOG00000059402 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ITGB1BP1 pAb (ATL-HPA067348) | |
Datasheet | Anti ITGB1BP1 pAb (ATL-HPA067348) Datasheet (External Link) |
Vendor Page | Anti ITGB1BP1 pAb (ATL-HPA067348) at Atlas Antibodies |
Documents & Links for Anti ITGB1BP1 pAb (ATL-HPA067348) | |
Datasheet | Anti ITGB1BP1 pAb (ATL-HPA067348) Datasheet (External Link) |
Vendor Page | Anti ITGB1BP1 pAb (ATL-HPA067348) |