Description
Product Description
Protein Description: integrin subunit beta 1
Gene Name: ITGB1
Alternative Gene Name: CD29, FNRB, GPIIA, MDF2, MSK12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025809: 90%, ENSRNOG00000010966: 88%
Entrez Gene ID: 3688
Uniprot ID: P05556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITGB1
Alternative Gene Name: CD29, FNRB, GPIIA, MDF2, MSK12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025809: 90%, ENSRNOG00000010966: 88%
Entrez Gene ID: 3688
Uniprot ID: P05556
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE |
Gene Sequence | FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE |
Gene ID - Mouse | ENSMUSG00000025809 |
Gene ID - Rat | ENSRNOG00000010966 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ITGB1 pAb (ATL-HPA069003 w/enhanced validation) | |
Datasheet | Anti ITGB1 pAb (ATL-HPA069003 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ITGB1 pAb (ATL-HPA069003 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ITGB1 pAb (ATL-HPA069003 w/enhanced validation) | |
Datasheet | Anti ITGB1 pAb (ATL-HPA069003 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ITGB1 pAb (ATL-HPA069003 w/enhanced validation) |