Anti ITGA4 pAb (ATL-HPA074961)

Catalog No:
ATL-HPA074961-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: integrin subunit alpha 4
Gene Name: ITGA4
Alternative Gene Name: CD49D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027009: 90%, ENSRNOG00000004861: 89%
Entrez Gene ID: 3676
Uniprot ID: P13612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR

Documents & Links for Anti ITGA4 pAb (ATL-HPA074961)
Datasheet Anti ITGA4 pAb (ATL-HPA074961) Datasheet (External Link)
Vendor Page Anti ITGA4 pAb (ATL-HPA074961) at Atlas

Documents & Links for Anti ITGA4 pAb (ATL-HPA074961)
Datasheet Anti ITGA4 pAb (ATL-HPA074961) Datasheet (External Link)
Vendor Page Anti ITGA4 pAb (ATL-HPA074961)