Protein Description: integrin subunit alpha 4
Gene Name: ITGA4
Alternative Gene Name: CD49D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027009: 90%, ENSRNOG00000004861: 89%
Entrez Gene ID: 3676
Uniprot ID: P13612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITGA4
Alternative Gene Name: CD49D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027009: 90%, ENSRNOG00000004861: 89%
Entrez Gene ID: 3676
Uniprot ID: P13612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RLLYCIKADPHCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR |
Documents & Links for Anti ITGA4 pAb (ATL-HPA074961) | |
Datasheet | Anti ITGA4 pAb (ATL-HPA074961) Datasheet (External Link) |
Vendor Page | Anti ITGA4 pAb (ATL-HPA074961) at Atlas |
Documents & Links for Anti ITGA4 pAb (ATL-HPA074961) | |
Datasheet | Anti ITGA4 pAb (ATL-HPA074961) Datasheet (External Link) |
Vendor Page | Anti ITGA4 pAb (ATL-HPA074961) |