Protein Description: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Gene Name: ITGA2
Alternative Gene Name: CD49B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015533: 78%, ENSRNOG00000058111: 80%
Entrez Gene ID: 3673
Uniprot ID: P17301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ITGA2
Alternative Gene Name: CD49B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015533: 78%, ENSRNOG00000058111: 80%
Entrez Gene ID: 3673
Uniprot ID: P17301
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ALEAYSETAKVFSIPFHKDCGEDGLCISDLVLDVRQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTGIVVDFSENLFFASFSLPV |
Documents & Links for Anti ITGA2 pAb (ATL-HPA063556 w/enhanced validation) | |
Datasheet | Anti ITGA2 pAb (ATL-HPA063556 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ITGA2 pAb (ATL-HPA063556 w/enhanced validation) at Atlas |
Documents & Links for Anti ITGA2 pAb (ATL-HPA063556 w/enhanced validation) | |
Datasheet | Anti ITGA2 pAb (ATL-HPA063556 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ITGA2 pAb (ATL-HPA063556 w/enhanced validation) |