Description
Product Description
Protein Description: isochorismatase domain containing 1
Gene Name: ISOC1
Alternative Gene Name: CGI-111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024601: 100%, ENSRNOG00000052099: 100%
Entrez Gene ID: 51015
Uniprot ID: Q96CN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ISOC1
Alternative Gene Name: CGI-111
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024601: 100%, ENSRNOG00000052099: 100%
Entrez Gene ID: 51015
Uniprot ID: Q96CN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV |
Gene Sequence | HIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV |
Gene ID - Mouse | ENSMUSG00000024601 |
Gene ID - Rat | ENSRNOG00000052099 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ISOC1 pAb (ATL-HPA070307) | |
Datasheet | Anti ISOC1 pAb (ATL-HPA070307) Datasheet (External Link) |
Vendor Page | Anti ISOC1 pAb (ATL-HPA070307) at Atlas Antibodies |
Documents & Links for Anti ISOC1 pAb (ATL-HPA070307) | |
Datasheet | Anti ISOC1 pAb (ATL-HPA070307) Datasheet (External Link) |
Vendor Page | Anti ISOC1 pAb (ATL-HPA070307) |