Protein Description: immunoglobulin superfamily containing leucine-rich repeat 2
Gene Name: ISLR2
Alternative Gene Name: KIAA1465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051243: 93%, ENSRNOG00000050714: 94%
Entrez Gene ID: 57611
Uniprot ID: Q6UXK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ISLR2
Alternative Gene Name: KIAA1465
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051243: 93%, ENSRNOG00000050714: 94%
Entrez Gene ID: 57611
Uniprot ID: Q6UXK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ESEKSYPAGGEAGGEEPEDVQGEGLDEDAEQGDPSGDLQREESLAACSLVESQSKANQEEFEAGSEYSDRLPLGAEAVNIAQEINGNYR |
| Documents & Links for Anti ISLR2 pAb (ATL-HPA067333) | |
| Datasheet | Anti ISLR2 pAb (ATL-HPA067333) Datasheet (External Link) |
| Vendor Page | Anti ISLR2 pAb (ATL-HPA067333) at Atlas |
| Documents & Links for Anti ISLR2 pAb (ATL-HPA067333) | |
| Datasheet | Anti ISLR2 pAb (ATL-HPA067333) Datasheet (External Link) |
| Vendor Page | Anti ISLR2 pAb (ATL-HPA067333) |