Anti ISL2 pAb (ATL-HPA075192)

Catalog No:
ATL-HPA075192-25
$303.00

Description

Product Description

Protein Description: ISL LIM homeobox 2
Gene Name: ISL2
Alternative Gene Name: FLJ10160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032318: 100%, ENSRNOG00000015336: 100%
Entrez Gene ID: 64843
Uniprot ID: Q96A47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
Gene Sequence MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
Gene ID - Mouse ENSMUSG00000032318
Gene ID - Rat ENSRNOG00000015336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ISL2 pAb (ATL-HPA075192)
Datasheet Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link)
Vendor Page Anti ISL2 pAb (ATL-HPA075192) at Atlas Antibodies

Documents & Links for Anti ISL2 pAb (ATL-HPA075192)
Datasheet Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link)
Vendor Page Anti ISL2 pAb (ATL-HPA075192)

Product Description

Protein Description: ISL LIM homeobox 2
Gene Name: ISL2
Alternative Gene Name: FLJ10160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032318: 100%, ENSRNOG00000015336: 100%
Entrez Gene ID: 64843
Uniprot ID: Q96A47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
Gene Sequence MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH
Gene ID - Mouse ENSMUSG00000032318
Gene ID - Rat ENSRNOG00000015336
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ISL2 pAb (ATL-HPA075192)
Datasheet Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link)
Vendor Page Anti ISL2 pAb (ATL-HPA075192) at Atlas Antibodies

Documents & Links for Anti ISL2 pAb (ATL-HPA075192)
Datasheet Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link)
Vendor Page Anti ISL2 pAb (ATL-HPA075192)