Protein Description: ISL LIM homeobox 2
Gene Name: ISL2
Alternative Gene Name: FLJ10160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032318: 100%, ENSRNOG00000015336: 100%
Entrez Gene ID: 64843
Uniprot ID: Q96A47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ISL2
Alternative Gene Name: FLJ10160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032318: 100%, ENSRNOG00000015336: 100%
Entrez Gene ID: 64843
Uniprot ID: Q96A47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIH |
| Documents & Links for Anti ISL2 pAb (ATL-HPA075192) | |
| Datasheet | Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link) |
| Vendor Page | Anti ISL2 pAb (ATL-HPA075192) at Atlas |
| Documents & Links for Anti ISL2 pAb (ATL-HPA075192) | |
| Datasheet | Anti ISL2 pAb (ATL-HPA075192) Datasheet (External Link) |
| Vendor Page | Anti ISL2 pAb (ATL-HPA075192) |