Description
Product Description
Protein Description: iroquois homeobox 3
Gene Name: IRX3
Alternative Gene Name: IRX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031734: 96%, ENSRNOG00000011533: 86%
Entrez Gene ID: 79191
Uniprot ID: P78415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IRX3
Alternative Gene Name: IRX-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031734: 96%, ENSRNOG00000011533: 86%
Entrez Gene ID: 79191
Uniprot ID: P78415
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSS |
| Gene Sequence | FARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSS |
| Gene ID - Mouse | ENSMUSG00000031734 |
| Gene ID - Rat | ENSRNOG00000011533 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti IRX3 pAb (ATL-HPA062522) | |
| Datasheet | Anti IRX3 pAb (ATL-HPA062522) Datasheet (External Link) |
| Vendor Page | Anti IRX3 pAb (ATL-HPA062522) at Atlas Antibodies |
| Documents & Links for Anti IRX3 pAb (ATL-HPA062522) | |
| Datasheet | Anti IRX3 pAb (ATL-HPA062522) Datasheet (External Link) |
| Vendor Page | Anti IRX3 pAb (ATL-HPA062522) |