Protein Description: interferon regulatory factor 6
Gene Name: IRF6
Alternative Gene Name: LPS, OFC6, VWS, VWS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026638: 95%, ENSRNOG00000005082: 96%
Entrez Gene ID: 3664
Uniprot ID: O14896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IRF6
Alternative Gene Name: LPS, OFC6, VWS, VWS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026638: 95%, ENSRNOG00000005082: 96%
Entrez Gene ID: 3664
Uniprot ID: O14896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDNDVDEE |
Documents & Links for Anti IRF6 pAb (ATL-HPA063121 w/enhanced validation) | |
Datasheet | Anti IRF6 pAb (ATL-HPA063121 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IRF6 pAb (ATL-HPA063121 w/enhanced validation) at Atlas |
Documents & Links for Anti IRF6 pAb (ATL-HPA063121 w/enhanced validation) | |
Datasheet | Anti IRF6 pAb (ATL-HPA063121 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti IRF6 pAb (ATL-HPA063121 w/enhanced validation) |