Anti IRF5 pAb (ATL-HPA076024)

Atlas Antibodies

Catalog No: ATL-HPA076024-25

• 

Product Description

Protein Description: interferon regulatory factor 5
Gene Name: IRF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029771: 98%, ENSRNOG00000007437: 98%
Entrez Gene ID: 3663
Uniprot ID: Q13568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE
• Gene Sequence: KPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE
• Gene ID - Mouse: ENSMUSG00000029771
• Gene ID - Rat: ENSRNOG00000007437
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.