Protein Description: interferon regulatory factor 2 binding protein 2
Gene Name: IRF2BP2
Alternative Gene Name: IRF-2BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051495: 96%, ENSRNOG00000049900: 94%
Entrez Gene ID: 359948
Uniprot ID: Q7Z5L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IRF2BP2
Alternative Gene Name: IRF-2BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051495: 96%, ENSRNOG00000049900: 94%
Entrez Gene ID: 359948
Uniprot ID: Q7Z5L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREV |
Documents & Links for Anti IRF2BP2 pAb (ATL-HPA062269) | |
Datasheet | Anti IRF2BP2 pAb (ATL-HPA062269) Datasheet (External Link) |
Vendor Page | Anti IRF2BP2 pAb (ATL-HPA062269) at Atlas |
Documents & Links for Anti IRF2BP2 pAb (ATL-HPA062269) | |
Datasheet | Anti IRF2BP2 pAb (ATL-HPA062269) Datasheet (External Link) |
Vendor Page | Anti IRF2BP2 pAb (ATL-HPA062269) |