Protein Description: iron-responsive element binding protein 2
Gene Name: IREB2
Alternative Gene Name: IRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032293: 90%, ENSRNOG00000013271: 90%
Entrez Gene ID: 3658
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IREB2
Alternative Gene Name: IRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032293: 90%, ENSRNOG00000013271: 90%
Entrez Gene ID: 3658
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRNDQNSSGEPEYSQVIQINLNSIVPSVSGP |
Documents & Links for Anti IREB2 pAb (ATL-HPA068982) | |
Datasheet | Anti IREB2 pAb (ATL-HPA068982) Datasheet (External Link) |
Vendor Page | Anti IREB2 pAb (ATL-HPA068982) at Atlas |
Documents & Links for Anti IREB2 pAb (ATL-HPA068982) | |
Datasheet | Anti IREB2 pAb (ATL-HPA068982) Datasheet (External Link) |
Vendor Page | Anti IREB2 pAb (ATL-HPA068982) |