Description
Product Description
Protein Description: IQ motif and Sec7 domain 2
Gene Name: IQSEC2
Alternative Gene Name: KIAA0522, MRX1, MRX18, MRX78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041115: 99%, ENSRNOG00000058975: 99%
Entrez Gene ID: 23096
Uniprot ID: Q5JU85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IQSEC2
Alternative Gene Name: KIAA0522, MRX1, MRX18, MRX78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041115: 99%, ENSRNOG00000058975: 99%
Entrez Gene ID: 23096
Uniprot ID: Q5JU85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS |
Gene Sequence | CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS |
Gene ID - Mouse | ENSMUSG00000041115 |
Gene ID - Rat | ENSRNOG00000058975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti IQSEC2 pAb (ATL-HPA076533) | |
Datasheet | Anti IQSEC2 pAb (ATL-HPA076533) Datasheet (External Link) |
Vendor Page | Anti IQSEC2 pAb (ATL-HPA076533) at Atlas Antibodies |
Documents & Links for Anti IQSEC2 pAb (ATL-HPA076533) | |
Datasheet | Anti IQSEC2 pAb (ATL-HPA076533) Datasheet (External Link) |
Vendor Page | Anti IQSEC2 pAb (ATL-HPA076533) |