Anti IQSEC2 pAb (ATL-HPA076533)

Catalog No:
ATL-HPA076533-25
$447.00

Description

Product Description

Protein Description: IQ motif and Sec7 domain 2
Gene Name: IQSEC2
Alternative Gene Name: KIAA0522, MRX1, MRX18, MRX78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041115: 99%, ENSRNOG00000058975: 99%
Entrez Gene ID: 23096
Uniprot ID: Q5JU85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS
Gene Sequence CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS
Gene ID - Mouse ENSMUSG00000041115
Gene ID - Rat ENSRNOG00000058975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti IQSEC2 pAb (ATL-HPA076533)
Datasheet Anti IQSEC2 pAb (ATL-HPA076533) Datasheet (External Link)
Vendor Page Anti IQSEC2 pAb (ATL-HPA076533) at Atlas Antibodies

Documents & Links for Anti IQSEC2 pAb (ATL-HPA076533)
Datasheet Anti IQSEC2 pAb (ATL-HPA076533) Datasheet (External Link)
Vendor Page Anti IQSEC2 pAb (ATL-HPA076533)

Product Description

Protein Description: IQ motif and Sec7 domain 2
Gene Name: IQSEC2
Alternative Gene Name: KIAA0522, MRX1, MRX18, MRX78
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041115: 99%, ENSRNOG00000058975: 99%
Entrez Gene ID: 23096
Uniprot ID: Q5JU85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS
Gene Sequence CSFEEYEKAQNPAYFEGKPASLDEGAMAGARSHRLERGLPYGGSCGGGIDGGGSSVTTSGEFSNDITELEDS
Gene ID - Mouse ENSMUSG00000041115
Gene ID - Rat ENSRNOG00000058975
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti IQSEC2 pAb (ATL-HPA076533)
Datasheet Anti IQSEC2 pAb (ATL-HPA076533) Datasheet (External Link)
Vendor Page Anti IQSEC2 pAb (ATL-HPA076533) at Atlas Antibodies

Documents & Links for Anti IQSEC2 pAb (ATL-HPA076533)
Datasheet Anti IQSEC2 pAb (ATL-HPA076533) Datasheet (External Link)
Vendor Page Anti IQSEC2 pAb (ATL-HPA076533)