Protein Description: inositol 1,3,4,5,6-pentakisphosphate 2-kinase
Gene Name: IPPK
Alternative Gene Name: C9orf12, FLJ13163, INSP5K2, IP5K, IPK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021385: 95%, ENSRNOG00000015631: 96%
Entrez Gene ID: 64768
Uniprot ID: Q9H8X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IPPK
Alternative Gene Name: C9orf12, FLJ13163, INSP5K2, IP5K, IPK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021385: 95%, ENSRNOG00000015631: 96%
Entrez Gene ID: 64768
Uniprot ID: Q9H8X2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR |
Documents & Links for Anti IPPK pAb (ATL-HPA020603) | |
Datasheet | Anti IPPK pAb (ATL-HPA020603) Datasheet (External Link) |
Vendor Page | Anti IPPK pAb (ATL-HPA020603) at Atlas |
Documents & Links for Anti IPPK pAb (ATL-HPA020603) | |
Datasheet | Anti IPPK pAb (ATL-HPA020603) Datasheet (External Link) |
Vendor Page | Anti IPPK pAb (ATL-HPA020603) |