Description
Product Description
Protein Description: integrator complex subunit 7
Gene Name: INTS7
Alternative Gene Name: C1orf73, DKFZP434B168, INT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037461: 95%, ENSRNOG00000004263: 95%
Entrez Gene ID: 25896
Uniprot ID: Q9NVH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INTS7
Alternative Gene Name: C1orf73, DKFZP434B168, INT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037461: 95%, ENSRNOG00000004263: 95%
Entrez Gene ID: 25896
Uniprot ID: Q9NVH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA |
Gene Sequence | GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA |
Gene ID - Mouse | ENSMUSG00000037461 |
Gene ID - Rat | ENSRNOG00000004263 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti INTS7 pAb (ATL-HPA072611) | |
Datasheet | Anti INTS7 pAb (ATL-HPA072611) Datasheet (External Link) |
Vendor Page | Anti INTS7 pAb (ATL-HPA072611) at Atlas Antibodies |
Documents & Links for Anti INTS7 pAb (ATL-HPA072611) | |
Datasheet | Anti INTS7 pAb (ATL-HPA072611) Datasheet (External Link) |
Vendor Page | Anti INTS7 pAb (ATL-HPA072611) |