Anti INTS7 pAb (ATL-HPA072611)

Catalog No:
ATL-HPA072611-25
$447.00

Description

Product Description

Protein Description: integrator complex subunit 7
Gene Name: INTS7
Alternative Gene Name: C1orf73, DKFZP434B168, INT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037461: 95%, ENSRNOG00000004263: 95%
Entrez Gene ID: 25896
Uniprot ID: Q9NVH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA
Gene Sequence GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA
Gene ID - Mouse ENSMUSG00000037461
Gene ID - Rat ENSRNOG00000004263
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti INTS7 pAb (ATL-HPA072611)
Datasheet Anti INTS7 pAb (ATL-HPA072611) Datasheet (External Link)
Vendor Page Anti INTS7 pAb (ATL-HPA072611) at Atlas Antibodies

Documents & Links for Anti INTS7 pAb (ATL-HPA072611)
Datasheet Anti INTS7 pAb (ATL-HPA072611) Datasheet (External Link)
Vendor Page Anti INTS7 pAb (ATL-HPA072611)

Product Description

Protein Description: integrator complex subunit 7
Gene Name: INTS7
Alternative Gene Name: C1orf73, DKFZP434B168, INT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037461: 95%, ENSRNOG00000004263: 95%
Entrez Gene ID: 25896
Uniprot ID: Q9NVH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA
Gene Sequence GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA
Gene ID - Mouse ENSMUSG00000037461
Gene ID - Rat ENSRNOG00000004263
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti INTS7 pAb (ATL-HPA072611)
Datasheet Anti INTS7 pAb (ATL-HPA072611) Datasheet (External Link)
Vendor Page Anti INTS7 pAb (ATL-HPA072611) at Atlas Antibodies

Documents & Links for Anti INTS7 pAb (ATL-HPA072611)
Datasheet Anti INTS7 pAb (ATL-HPA072611) Datasheet (External Link)
Vendor Page Anti INTS7 pAb (ATL-HPA072611)