Protein Description: insulin-like 5
Gene Name: INSL5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066090: 57%, ENSRNOG00000023521: 29%
Entrez Gene ID: 10022
Uniprot ID: Q9Y5Q6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INSL5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066090: 57%, ENSRNOG00000023521: 29%
Entrez Gene ID: 10022
Uniprot ID: Q9Y5Q6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR |
Documents & Links for Anti INSL5 pAb (ATL-HPA030100 w/enhanced validation) | |
Datasheet | Anti INSL5 pAb (ATL-HPA030100 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti INSL5 pAb (ATL-HPA030100 w/enhanced validation) at Atlas |
Documents & Links for Anti INSL5 pAb (ATL-HPA030100 w/enhanced validation) | |
Datasheet | Anti INSL5 pAb (ATL-HPA030100 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti INSL5 pAb (ATL-HPA030100 w/enhanced validation) |