Description
Product Description
Protein Description: insulin like 4
Gene Name: INSL4
Alternative Gene Name: EPIL
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 3641
Uniprot ID: Q14641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INSL4
Alternative Gene Name: EPIL
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 3641
Uniprot ID: Q14641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGT |
| Gene Sequence | AAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGT |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti INSL4 pAb (ATL-HPA065145) | |
| Datasheet | Anti INSL4 pAb (ATL-HPA065145) Datasheet (External Link) |
| Vendor Page | Anti INSL4 pAb (ATL-HPA065145) at Atlas Antibodies |
| Documents & Links for Anti INSL4 pAb (ATL-HPA065145) | |
| Datasheet | Anti INSL4 pAb (ATL-HPA065145) Datasheet (External Link) |
| Vendor Page | Anti INSL4 pAb (ATL-HPA065145) |