Protein Description: inositol polyphosphate-5-phosphatase, 72 kDa
Gene Name: INPP5E
Alternative Gene Name: CORS1, JBTS1, PPI5PIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026925: 90%, ENSRNOG00000019039: 91%
Entrez Gene ID: 56623
Uniprot ID: Q9NRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INPP5E
Alternative Gene Name: CORS1, JBTS1, PPI5PIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026925: 90%, ENSRNOG00000019039: 91%
Entrez Gene ID: 56623
Uniprot ID: Q9NRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS |
| Documents & Links for Anti INPP5E pAb (ATL-HPA065758) | |
| Datasheet | Anti INPP5E pAb (ATL-HPA065758) Datasheet (External Link) |
| Vendor Page | Anti INPP5E pAb (ATL-HPA065758) at Atlas |
| Documents & Links for Anti INPP5E pAb (ATL-HPA065758) | |
| Datasheet | Anti INPP5E pAb (ATL-HPA065758) Datasheet (External Link) |
| Vendor Page | Anti INPP5E pAb (ATL-HPA065758) |
| Citations for Anti INPP5E pAb (ATL-HPA065758) – 1 Found |
| Sierra Potchanant, Elizabeth A; Cerabona, Donna; Sater, Zahi Abdul; He, Ying; Sun, Zejin; Gehlhausen, Jeff; Nalepa, Grzegorz. INPP5E Preserves Genomic Stability through Regulation of Mitosis. Molecular And Cellular Biology. 2017;37(6) PubMed |