Description
Product Description
Protein Description: inositol polyphosphate-5-phosphatase, 72 kDa
Gene Name: INPP5E
Alternative Gene Name: CORS1, JBTS1, PPI5PIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026925: 90%, ENSRNOG00000019039: 91%
Entrez Gene ID: 56623
Uniprot ID: Q9NRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INPP5E
Alternative Gene Name: CORS1, JBTS1, PPI5PIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026925: 90%, ENSRNOG00000019039: 91%
Entrez Gene ID: 56623
Uniprot ID: Q9NRR6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS |
Gene Sequence | GKDTYDSTSKQRTPSYTDRVLYRSRHKGDICPVSYSSCPGIKTSDHRPVYGLFRVKVRPGRDNIPLAAGKFDRELYLLGIKRRISKEIQRQQALQSQNSSTICSVS |
Gene ID - Mouse | ENSMUSG00000026925 |
Gene ID - Rat | ENSRNOG00000019039 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti INPP5E pAb (ATL-HPA065758) | |
Datasheet | Anti INPP5E pAb (ATL-HPA065758) Datasheet (External Link) |
Vendor Page | Anti INPP5E pAb (ATL-HPA065758) at Atlas Antibodies |
Documents & Links for Anti INPP5E pAb (ATL-HPA065758) | |
Datasheet | Anti INPP5E pAb (ATL-HPA065758) Datasheet (External Link) |
Vendor Page | Anti INPP5E pAb (ATL-HPA065758) |
Citations
Citations for Anti INPP5E pAb (ATL-HPA065758) – 1 Found |
Sierra Potchanant, Elizabeth A; Cerabona, Donna; Sater, Zahi Abdul; He, Ying; Sun, Zejin; Gehlhausen, Jeff; Nalepa, Grzegorz. INPP5E Preserves Genomic Stability through Regulation of Mitosis. Molecular And Cellular Biology. 2017;37(6) PubMed |