![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100588/180513/atl-hpa070455_anti-inpp5d-pab-atl-hpa070455_62181__85772.1681136620.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue")
Protein Description: inositol polyphosphate-5-phosphatase, 145kDa
Gene Name: INPP5D
Alternative Gene Name: hp51CN, SHIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026288: 69%, ENSRNOG00000017020: 68%
Entrez Gene ID: 3635
Uniprot ID: Q92835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INPP5D
Alternative Gene Name: hp51CN, SHIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026288: 69%, ENSRNOG00000017020: 68%
Entrez Gene ID: 3635
Uniprot ID: Q92835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT |
| Documents & Links for Anti INPP5D pAb (ATL-HPA070455) | |
| Datasheet | Anti INPP5D pAb (ATL-HPA070455) Datasheet (External Link) |
| Vendor Page | Anti INPP5D pAb (ATL-HPA070455) at Atlas |
| Documents & Links for Anti INPP5D pAb (ATL-HPA070455) | |
| Datasheet | Anti INPP5D pAb (ATL-HPA070455) Datasheet (External Link) |
| Vendor Page | Anti INPP5D pAb (ATL-HPA070455) |