Anti INPP5D pAb (ATL-HPA070455)

Atlas Antibodies

Catalog No: ATL-HPA070455-25

• 
• 
• 

Product Description

Protein Description: inositol polyphosphate-5-phosphatase, 145kDa
Gene Name: INPP5D
Alternative Gene Name: hp51CN, SHIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026288: 69%, ENSRNOG00000017020: 68%
Entrez Gene ID: 3635
Uniprot ID: Q92835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT
• Gene Sequence: MPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQT
• Gene ID - Mouse: ENSMUSG00000026288
• Gene ID - Rat: ENSRNOG00000017020
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.