Anti INO80B pAb (ATL-HPA070644)

Atlas Antibodies

Catalog No: ATL-HPA070644-25

• 

Product Description

Protein Description: INO80 complex subunit B
Gene Name: INO80B
Alternative Gene Name: hIes2, HMGA1L4, HMGIYL4, IES2, PAP-1BP, PAPA-1, ZNHIT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030034: 95%, ENSRNOG00000057972: 96%
Entrez Gene ID: 83444
Uniprot ID: Q9C086
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
• Gene Sequence: GQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREER
• Gene ID - Mouse: ENSMUSG00000030034
• Gene ID - Rat: ENSRNOG00000057972
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.