Protein Description: IMP4, U3 small nucleolar ribonucleoprotein
Gene Name: IMP4
Alternative Gene Name: BXDC4, MGC19606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026127: 98%, ENSRNOG00000013285: 98%
Entrez Gene ID: 92856
Uniprot ID: Q96G21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IMP4
Alternative Gene Name: BXDC4, MGC19606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026127: 98%, ENSRNOG00000013285: 98%
Entrez Gene ID: 92856
Uniprot ID: Q96G21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKE |
| Documents & Links for Anti IMP4 pAb (ATL-HPA066673) | |
| Datasheet | Anti IMP4 pAb (ATL-HPA066673) Datasheet (External Link) |
| Vendor Page | Anti IMP4 pAb (ATL-HPA066673) at Atlas |
| Documents & Links for Anti IMP4 pAb (ATL-HPA066673) | |
| Datasheet | Anti IMP4 pAb (ATL-HPA066673) Datasheet (External Link) |
| Vendor Page | Anti IMP4 pAb (ATL-HPA066673) |