Protein Description: IMP4, U3 small nucleolar ribonucleoprotein
Gene Name: IMP4
Alternative Gene Name: BXDC4, MGC19606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026127: 100%, ENSRNOG00000013285: 100%
Entrez Gene ID: 92856
Uniprot ID: Q96G21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IMP4
Alternative Gene Name: BXDC4, MGC19606
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026127: 100%, ENSRNOG00000013285: 100%
Entrez Gene ID: 92856
Uniprot ID: Q96G21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR |
Documents & Links for Anti IMP4 pAb (ATL-HPA066222) | |
Datasheet | Anti IMP4 pAb (ATL-HPA066222) Datasheet (External Link) |
Vendor Page | Anti IMP4 pAb (ATL-HPA066222) at Atlas |
Documents & Links for Anti IMP4 pAb (ATL-HPA066222) | |
Datasheet | Anti IMP4 pAb (ATL-HPA066222) Datasheet (External Link) |
Vendor Page | Anti IMP4 pAb (ATL-HPA066222) |