Description
Product Description
Protein Description: ilvB (bacterial acetolactate synthase)-like
Gene Name: ILVBL
Alternative Gene Name: 209L8, AHAS, FLJ39061, ILV2H, MGC1269, MGC19535
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032763: 85%, ENSRNOG00000028512: 89%
Entrez Gene ID: 10994
Uniprot ID: A1L0T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ILVBL
Alternative Gene Name: 209L8, AHAS, FLJ39061, ILV2H, MGC1269, MGC19535
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032763: 85%, ENSRNOG00000028512: 89%
Entrez Gene ID: 10994
Uniprot ID: A1L0T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWYL |
Gene Sequence | LLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWYL |
Gene ID - Mouse | ENSMUSG00000032763 |
Gene ID - Rat | ENSRNOG00000028512 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ILVBL pAb (ATL-HPA067682) | |
Datasheet | Anti ILVBL pAb (ATL-HPA067682) Datasheet (External Link) |
Vendor Page | Anti ILVBL pAb (ATL-HPA067682) at Atlas Antibodies |
Documents & Links for Anti ILVBL pAb (ATL-HPA067682) | |
Datasheet | Anti ILVBL pAb (ATL-HPA067682) Datasheet (External Link) |
Vendor Page | Anti ILVBL pAb (ATL-HPA067682) |