Anti ILVBL pAb (ATL-HPA067682)

Atlas Antibodies

Catalog No: ATL-HPA067682-25

• 
• 

Product Description

Protein Description: ilvB (bacterial acetolactate synthase)-like
Gene Name: ILVBL
Alternative Gene Name: 209L8, AHAS, FLJ39061, ILV2H, MGC1269, MGC19535
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032763: 85%, ENSRNOG00000028512: 89%
Entrez Gene ID: 10994
Uniprot ID: A1L0T0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWYL
• Gene Sequence: LLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPYFMVQKEMVPAKPPKGLVGRVVSWYL
• Gene ID - Mouse: ENSMUSG00000032763
• Gene ID - Rat: ENSRNOG00000028512
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.