Anti IL9R pAb (ATL-HPA064557)

Atlas Antibodies

Catalog No: ATL-HPA064557-25

• 

Product Description

Protein Description: interleukin 9 receptor
Gene Name: IL9R
Alternative Gene Name: CD129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037032: 24%, ENSRNOG00000005347: 24%
Entrez Gene ID: 3581
Uniprot ID: Q01113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF
• Gene Sequence: SNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF
• Gene ID - Mouse: ENSMUSG00000037032
• Gene ID - Rat: ENSRNOG00000005347
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.