Protein Description: interleukin 9 receptor
Gene Name: IL9R
Alternative Gene Name: CD129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037032: 24%, ENSRNOG00000005347: 24%
Entrez Gene ID: 3581
Uniprot ID: Q01113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL9R
Alternative Gene Name: CD129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037032: 24%, ENSRNOG00000005347: 24%
Entrez Gene ID: 3581
Uniprot ID: Q01113
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWVLAGHCQRPGLHEDLQGMLLPSVLSKARSWTF |
| Documents & Links for Anti IL9R pAb (ATL-HPA064557) | |
| Datasheet | Anti IL9R pAb (ATL-HPA064557) Datasheet (External Link) |
| Vendor Page | Anti IL9R pAb (ATL-HPA064557) at Atlas |
| Documents & Links for Anti IL9R pAb (ATL-HPA064557) | |
| Datasheet | Anti IL9R pAb (ATL-HPA064557) Datasheet (External Link) |
| Vendor Page | Anti IL9R pAb (ATL-HPA064557) |