Anti IL7R pAb (ATL-HPA067550)

Atlas Antibodies

Catalog No: ATL-HPA067550-25

• 
• 

Product Description

Protein Description: interleukin 7 receptor
Gene Name: IL7R
Alternative Gene Name: CD127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003882: 60%, ENSRNOG00000058446: 66%
Entrez Gene ID: 3575
Uniprot ID: P16871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
• Gene Sequence: HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
• Gene ID - Mouse: ENSMUSG00000003882
• Gene ID - Rat: ENSRNOG00000058446
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.