![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100070/179826/atl-hpa067550_anti-il7r-pab-atl-hpa067550_61489__52622.1681135639.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: interleukin 7 receptor
Gene Name: IL7R
Alternative Gene Name: CD127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003882: 60%, ENSRNOG00000058446: 66%
Entrez Gene ID: 3575
Uniprot ID: P16871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL7R
Alternative Gene Name: CD127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003882: 60%, ENSRNOG00000058446: 66%
Entrez Gene ID: 3575
Uniprot ID: P16871
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES |
| Documents & Links for Anti IL7R pAb (ATL-HPA067550) | |
| Datasheet | Anti IL7R pAb (ATL-HPA067550) Datasheet (External Link) |
| Vendor Page | Anti IL7R pAb (ATL-HPA067550) at Atlas |
| Documents & Links for Anti IL7R pAb (ATL-HPA067550) | |
| Datasheet | Anti IL7R pAb (ATL-HPA067550) Datasheet (External Link) |
| Vendor Page | Anti IL7R pAb (ATL-HPA067550) |