Protein Description: interleukin 31 receptor A
Gene Name: IL31RA
Alternative Gene Name: CRL, CRL3, GLM-R, Glmr, IL-31RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050377: 52%, ENSRNOG00000042080: 51%
Entrez Gene ID: 133396
Uniprot ID: Q8NI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL31RA
Alternative Gene Name: CRL, CRL3, GLM-R, Glmr, IL-31RA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050377: 52%, ENSRNOG00000042080: 51%
Entrez Gene ID: 133396
Uniprot ID: Q8NI17
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR |
Documents & Links for Anti IL31RA pAb (ATL-HPA068114) | |
Datasheet | Anti IL31RA pAb (ATL-HPA068114) Datasheet (External Link) |
Vendor Page | Anti IL31RA pAb (ATL-HPA068114) at Atlas |
Documents & Links for Anti IL31RA pAb (ATL-HPA068114) | |
Datasheet | Anti IL31RA pAb (ATL-HPA068114) Datasheet (External Link) |
Vendor Page | Anti IL31RA pAb (ATL-HPA068114) |